Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML077W  from Saccharomyces cerevisiae S288C
>YML077W|YML077W BET5 SGDID:S000004542, Chr XIII from 111865-112344, Genome Release 64-1-1, Verified ORF, "Component of the TRAPP (transport protein particle) complex, which plays an essential role in the vesicular transport from endoplasmic reticulum to Golgi" ORGANISM: Saccharomyces cerevisiae S288C (159 aa)
MGIYSFWIFDRHCNCIFDREWTLASNSASGTINSKQNEEDAKLLYGMIFSLRSITQKLSK
GSVKNDIRSISTGKYRVHTYCTASGLWFVLLSDFKQQSYTQVLQYIYSHIYVKYVSNNLL
SPYDFAENENEMRGQGTRKITNRNFISVLESFLAPMVNQ