Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML073C  from Saccharomyces cerevisiae S288C
>YML073C|YML073C RPL6A SGDID:S000004538, Chr XIII from 123742-123227,124172-124158, Genome Release 64-1-1, reverse complement, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, has similarity to Rpl6Bp and to rat L6 ribosomal protein; binds to 5.8S rRNA" ORGANISM: Saccharomyces cerevisiae S288C (176 aa)
MSAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLED
NTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKFNVEYFAKEKLTKKEKKEAN
LFPEQQNKEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDKPHMLKF