Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML058W-A  from Saccharomyces cerevisiae S288C
>YML058W-A|YML058W-A HUG1 SGDID:S000007472, Chr XIII from 158760-158966, Genome Release 64-1-1, Verified ORF, "Protein involved in the Mec1p-mediated checkpoint pathway that responds to DNA damage or replication arrest, transcription is induced by DNA damage" ORGANISM: Saccharomyces cerevisiae S288C (68 aa)
MTMDQGLNPKQFFLDDVVLQDTLCSMSNRVNKSVKTGYLFPKDHVPSANIIAVERRGGLS
DIGKNTSN