Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YML054C-A  from Saccharomyces cerevisiae S288C
>YML054C-A|YML054C-A YML054C-A SGDID:S000028573, Chr XIII from 167781-167623, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (52 aa)
MIPFPAQHEIFHAYIGRITPHSSRCIANMWHSAHFFHENSLSIMKTLVPWTL