Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML053C  from Saccharomyces cerevisiae S288C
>YML053C|YML053C YML053C SGDID:S000004517, Chr XIII from 169754-169116, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and the nucleus; overexpression causes a cell cycle delay or arrest; YML053C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (212 aa)
MLSYYEHNTAFQTNNCNSGSNAATTYNSDANNDTIMNKRKNDHFEFDTHTFYQRSKRTKR
DSVSTKFSVGSGCANLNNNNNNIIINNNNNNNNNNNNHNHNNSNNTATYNNIHYKKNIEI
CPLKPVSMHHTMNSRLLNESEFYSETEEYMIHGYFGNTNRDITGTSPTGSASIIQHQYHL
LPSQSIIASQAPGTAMAALTNNNIANDYMDID