Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML036W  from Saccharomyces cerevisiae S288C
>YML036W|YML036W CGI121 SGDID:S000004500, Chr XIII from 205642-206097,206204-206293, Genome Release 64-1-1, Verified ORF, "Component of the EKC/KEOPS complex with Bud32p, Kae1p, Pcc1p, and Gon7p; EKC/KEOPS complex is required for t6A tRNA modification and may have roles in telomere maintenance and transcription; Cgi121p is dispensable for tRNA modification" ORGANISM: Saccharomyces cerevisiae S288C (181 aa)
MVVSIIPQFPDIKVSLALFEQVKNAKEIRSKMSELSTSFAFIDPRLVCSGEQMYSAIYKT
LIEVKYNKMRTRNLNSECVLCLSPTSNISDAFLKFGIKDDSSQLICLKFHTNTDDVDKEQ
LRTIMTSIVKGQEIEFNDDNLSRFYDEALIRKIYKLSDDFKPQDVNGLSRALVDAIQLRG
V