Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YML009C  from Saccharomyces cerevisiae S288C
>YML009C|YML009C MRPL39 SGDID:S000004468, Chr XIII from 251516-251304, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" ORGANISM: Saccharomyces cerevisiae S288C (70 aa)
MVKVKSKNSVIKLLSTAASGYSRYISIKKGAPLVTQVRYDPVVKRHVLFKEAKKRKVAER
KPLDFLRTAK