Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YML007C-A  from Saccharomyces cerevisiae S288C
>YML007C-A|YML007C-A YML007C-A SGDID:S000007621, Chr XIII from 253272-253162, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to mitochondria" ORGANISM: Saccharomyces cerevisiae S288C (36 aa)
MVHFIFIALRSMRFMRRLVRNLQYLLLPITSSLLFI