Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR466C-B  from Saccharomyces cerevisiae S288C
>YLR466C-B|YLR466C-B YLR466C-B SGDID:S000028686, Chr XII from 1071710-1071594, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data" ORGANISM: Saccharomyces cerevisiae S288C (38 aa)
MSLRPCLTPSSMQYSDIYIPTHSLTSTSTLAVIPYPAF