Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR461W  from Saccharomyces cerevisiae S288C
>YLR461W|YLR461W PAU4 SGDID:S000004453, Chr XII from 1062919-1063281, Genome Release 64-1-1, Verified ORF, "Member of the seripauperin multigene family encoded mainly in subtelomeric regions; active during alcoholic fermentation, regulated by anaerobiosis, negatively regulated by oxygen, repressed by heme" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVKLTSIAAGVAAIAATASATTTIAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISKALSKDGIYTIAN