Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR448W  from Saccharomyces cerevisiae S288C
>YLR448W|YLR448W RPL6B SGDID:S000004440, Chr XII from 1028854-1028868,1029253-1029768, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl6Ap and to rat L6 ribosomal protein; binds to 5.8S rRNA" ORGANISM: Saccharomyces cerevisiae S288C (176 aa)
MTAQQAPKWYPSEDVAAPKKTRKAVRPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLED
NTLLVTGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKFNVEYFAKEKLTKKEKKEAN
LFPEQQTKEIKTERVEDQKVVDKALLAEIKKTPLLKQYLSASFSLKNGDKPHLLKF