>YLR438C-A|YLR438C-A LSM3 SGDID:S000006434, Chr XII from 1014178-1013909, Genome Release 64-1-1, reverse complement, Verified ORF, "Lsm (Like Sm) protein; part of heteroheptameric complexes (Lsm2p-7p and either Lsm1p or 8p): cytoplasmic Lsm1p complex involved in mRNA decay; nuclear Lsm8p complex part of U6 snRNP and possibly involved in processing tRNA, snoRNA, and rRNA" ORGANISM: Saccharomyces cerevisiae S288C (89 aa)
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESE
RRCEMVFIRGDTVTLISTPSEDDDGAVEI