Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR437C  from Saccharomyces cerevisiae S288C
>YLR437C|YLR437C DIF1 SGDID:S000004429, Chr XII from 1012023-1011622, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein that regulates the nuclear localization of ribonucleotide reductase Rnr2p and Rnr4p subunits; phosphorylated by Dun1p in response to DNA damage and degraded; N-terminal half has similarity to S. pombe Spd1 protein" ORGANISM: Saccharomyces cerevisiae S288C (133 aa)
MDAQLEWASSLVPKRQLQQQQQQQEQQQQQQQDFHKDQLMTVGMRIRQRVDQGYASRTPS
TSDASLQPGVIRDYSSVIVPQFTRSPLPTANSLPPMLINQRTMSTEASSLEKWDVAEPAA
EHETMVNGSKRRL