Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR421C  from Saccharomyces cerevisiae S288C
>YLR421C|YLR421C RPN13 SGDID:S000004413, Chr XII from 965560-965090, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the 19S regulatory particle of the 26S proteasome lid; acts as a ubiquitin receptor for the proteasome; null mutants accumulate ubiquitinated Gcn4p and display decreased 26S proteasome stability" ORGANISM: Saccharomyces cerevisiae S288C (156 aa)
MSMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRE
LDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKE
IYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD