Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR408C  from Saccharomyces cerevisiae S288C
>YLR408C|YLR408C BLS1 SGDID:S000004400, Chr XII from 934253-933885, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; likely member of BLOC complex involved in endosomal cargo sorting; green fluorescent protein (GFP)-fusion protein localizes to the endosome; YLR408C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MFLTFSMCVNWIIVKMPNRSEELDRLLDKIINSPHRTEASKTLQEIENNQSYILNVQLKK
LLRLHDDSFKNKCVSPINYMLEKYTPYMGHTEALQKEAELVDRDLRILEMTYQLIEKNRN
SK