Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR406C-A  from Saccharomyces cerevisiae S288C
>YLR406C-A|YLR406C-A YLR406C-A SGDID:S000028683, Chr XII from 932355-932206, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (49 aa)
MIQKPILLSSFLFLYIRALLHSIHPYIRTSVHLYTKKITSYNFLGVPFK