Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR406C  from Saccharomyces cerevisiae S288C
>YLR406C|YLR406C RPL31B SGDID:S000004398, Chr XII from 931349-931065,931755-931699, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Ap and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p; loss of both Rpl31p and Rpl39p confers lethality" ORGANISM: Saccharomyces cerevisiae S288C (113 aa)
MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTEDVRLAPELNQAIW
KRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA