Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR395C  from Saccharomyces cerevisiae S288C
>YLR395C|YLR395C COX8 SGDID:S000004387, Chr XII from 909965-909729, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit VIII of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain" ORGANISM: Saccharomyces cerevisiae S288C (78 aa)
MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYALSHFGFFAIG
FAVPFVACYVQLKKSGAF