Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR388W  from Saccharomyces cerevisiae S288C
>YLR388W|YLR388W RPS29A SGDID:S000004380, Chr XII from 898651-898821, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps29Bp and has similarity to rat S29 and E. coli S14 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (56 aa)
MAHENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFNKFR