Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR385C  from Saccharomyces cerevisiae S288C
>YLR385C|YLR385C SWC7 SGDID:S000004377, Chr XII from 893390-892992, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, component of the Swr1p complex that incorporates Htz1p into chromatin" ORGANISM: Saccharomyces cerevisiae S288C (132 aa)
MDCPSNVVLLLLQLVLQRQQTLAHRDKSVDLQTLLKDPVIDNDVLVEFKTHKLVQLYGPQ
YCRDISLRGLKTMVTDIFANGIPKNAQSSGNDQPVTVVDLANYYYMQRINELQNTELPQL
KEALLTRLEHMI