Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR364W  from Saccharomyces cerevisiae S288C
>YLR364W|YLR364W GRX8 SGDID:S000004356, Chr XII from 854062-854391, Genome Release 64-1-1, Verified ORF, "Glutaredoxin that employs a dithiol mechanism of catalysis; monomeric; activity is low and null mutation does not affect sensitivity to oxidative stress; GFP-fusion protein localizes to the cytoplasm; expression strongly induced by arsenic" ORGANISM: Saccharomyces cerevisiae S288C (109 aa)
MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKW
RIAFQKVVGSRNLPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP