Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR356W  from Saccharomyces cerevisiae S288C
>YLR356W|YLR356W ATG33 SGDID:S000004348, Chr XII from 840321-840914, Genome Release 64-1-1, Verified ORF, "Mitochondrial mitophagy-specific protein; required primarily for mitophagy induced at the post-log phase; not required for other types of selective autophagy or macroautophagy; conserved within fungi, but not in higher eukaryotes" ORGANISM: Saccharomyces cerevisiae S288C (197 aa)
MSVCLAITKGIAVSSIGLYSGLLASASLITSTTPLEVLTGSLTPTLTTLKNAATALGAFA
STFFCVSFFGAPPSLRHPYLLYGMLVAPLSSFVLGCASNYQSRKYSKVSKESSLFPEDSK
LAASELSDSIIDLGEDNHASENTPRDGKPAATTVSKPAEALHTGPPIHTKNLIAATAIAI
VGFVQAVIGVYGEGQFI