Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR346C  from Saccharomyces cerevisiae S288C
>YLR346C|YLR346C YLR346C SGDID:S000004338, Chr XII from 822592-822287, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function found in mitochondria; expression is regulated by transcription factors involved in pleiotropic drug resistance, Pdr1p and Yrr1p; YLR346C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (101 aa)
MQSISNCPIGLVSKNTINSASTIAEWVACPWKYINVVGSGRYVSNKPDKITRYDLLKAAQ
EAEMQELLTRNDMKGRHKRNKKSKIALETIAEENSSTESLF