Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR344W  from Saccharomyces cerevisiae S288C
>YLR344W|YLR344W RPL26A SGDID:S000004336, Chr XII from 819312-819330,819778-820142, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl26Bp and has similarity to E. coli L24 and rat L26 ribosomal proteins; binds to 5.8S rRNA" ORGANISM: Saccharomyces cerevisiae S288C (127 aa)
MAKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVR
GSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHPSKLVITKLHLDKDRKALIQ
RKGGKLE