Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR333C  from Saccharomyces cerevisiae S288C
>YLR333C|YLR333C RPS25B SGDID:S000004325, Chr XII from 795899-795573, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Ap and has similarity to rat S25 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (108 aa)
MPPKQQLSKAAKAAAALAGGKKSKKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYV
SVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRAAASE