Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR327C  from Saccharomyces cerevisiae S288C
>YLR327C|YLR327C TMA10 SGDID:S000004319, Chr XII from 783387-783127, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function that associates with ribosomes; putative homolog of the F1F0-ATPase synthase regulator Stf2p" ORGANISM: Saccharomyces cerevisiae S288C (86 aa)
MTRTSKWTVHEAKSNPKYFTHNGNFGESPNHVKRGGYGKGNWGKPGDEINDLIDSGEIKT
VFNKTRRGSNSQNNERRLSDLQQYHI