Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR325C  from Saccharomyces cerevisiae S288C
>YLR325C|YLR325C RPL38 SGDID:S000004317, Chr XII from 781379-781143, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L38 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (78 aa)
MAREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSLYTLVINDAG
KAKKLIQSLPPTLKVNRL