Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR297W  from Saccharomyces cerevisiae S288C
>YLR297W|YLR297W YLR297W SGDID:S000004288, Chr XII from 724044-724433, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the vacuole; YLR297W is not an essential gene; induced by treatment with 8-methoxypsoralen and UVA irradiation" ORGANISM: Saccharomyces cerevisiae S288C (129 aa)
MVEGDFVDEQSNIALLSSKSMCGDHHSVKNSIGDEIFKLLTKILNSDEKASGDVHTLVSG
TPDLSNFNLDNEPLENILAVFIISFIIVVVGVLLLGLIGMIFISLRSGSSNDKKLQSNDE
EKQALAEKA