Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR295C  from Saccharomyces cerevisiae S288C
>YLR295C|YLR295C ATP14 SGDID:S000004286, Chr XII from 722373-721999, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit h of the F0 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" ORGANISM: Saccharomyces cerevisiae S288C (124 aa)
MFPIASRRILLNASVLPLRLCNRNFTTTRISYNVIQDLYLRELKDTKLAPSTLQDAEGNV
KPWNPPQKPNLPELELQGPEALKAYTEQNVETAHVAKESEEGESEPIEEDWLVLDDAEET
KESH