Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR293C  from Saccharomyces cerevisiae S288C
>YLR293C|YLR293C GSP1 SGDID:S000004284, Chr XII from 721430-720771, Genome Release 64-1-1, reverse complement, Verified ORF, "Ran GTPase, GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; regulated by Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and Kap95p; yeast Gsp2p homolog" ORGANISM: Saccharomyces cerevisiae S288C (219 aa)
MSAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE
IKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIV
LCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVA
SPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL