Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR287C-A  from Saccharomyces cerevisiae S288C
>YLR287C-A|YLR287C-A RPS30A SGDID:S000004278, Chr XII from 712725-712537,713158-713156, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps30Bp and has similarity to rat S30 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (63 aa)
MAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGP
SVQ