Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR285C-A  from Saccharomyces cerevisiae S288C
>YLR285C-A|YLR285C-A YLR285C-A SGDID:S000028569, Chr XII from 708338-708168, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (56 aa)
MFLRFYNRLLYIYNELFNFLRFTVFLPFCEFVPHHDLFYLIVTYQRTLVYKHKNDC