Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR268W  from Saccharomyces cerevisiae S288C
>YLR268W|YLR268W SEC22 SGDID:S000004258, Chr XII from 680200-680844, Genome Release 64-1-1, Verified ORF, "R-SNARE protein; assembles into SNARE complex with Bet1p, Bos1p and Sed5p; cycles between the ER and Golgi complex; involved in anterograde and retrograde transport between the ER and Golgi; synaptobrevin homolog" ORGANISM: Saccharomyces cerevisiae S288C (214 aa)
MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHY
LKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMT
KKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRK
SAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK