Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR264W  from Saccharomyces cerevisiae S288C
>YLR264W|YLR264W RPS28B SGDID:S000004254, Chr XII from 673131-673334, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps28Ap and has similarity to rat S28 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (67 aa)
MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDILVLMESE
REARRLR