Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR264C-A  from Saccharomyces cerevisiae S288C
>YLR264C-A|YLR264C-A YLR264C-A SGDID:S000028808, Chr XII from 673944-673828, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (38 aa)
MNVIFKLYLTIDAPKKKKVTVRDFLSIRYSMPYRLASN