Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR262C-A  from Saccharomyces cerevisiae S288C
>YLR262C-A|YLR262C-A TMA7 SGDID:S000007246, Chr XII from 669662-669468, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown that associates with ribosomes; null mutant exhibits translation defects, altered polyribosome profiles, and resistance to the translation inhibitor anisomcyin" ORGANISM: Saccharomyces cerevisiae S288C (64 aa)
MSSRQGGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKSGKPLVGGGIKK
SGKK