Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR262C  from Saccharomyces cerevisiae S288C
>YLR262C|YLR262C YPT6 SGDID:S000004252, Chr XII from 668891-668244, Genome Release 64-1-1, reverse complement, Verified ORF, "Rab family GTPase, Ras-like GTP binding protein involved in the secretory pathway, required for fusion of endosome-derived vesicles with the late Golgi, maturation of the vacuolar carboxypeptidase Y; has similarity to the human GTPase, Rab6" ORGANISM: Saccharomyces cerevisiae S288C (215 aa)
MSRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIR
LQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILC
IVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSE
STPLDSENANSANQNKPGVIDISTAEEQEQSACQC