Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR245C  from Saccharomyces cerevisiae S288C
>YLR245C|YLR245C CDD1 SGDID:S000004235, Chr XII from 626930-626502, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytidine deaminase; catalyzes the modification of cytidine to uridine in vitro but native RNA substrates have not been identified, localizes to both the nucleus and cytoplasm" ORGANISM: Saccharomyces cerevisiae S288C (142 aa)
MKVGGIEDRQLEALKRAALKACELSYSPYSHFRVGCSILTNNDVIFTGANVENASYSNCI
CAERSAMIQVLMAGHRSGWKCMVICGDSEDQCVSPCGVCRQFINEFVVKDFPIVMLNSTG
SRSKVMTMGELLPMAFGPSHLN