Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR221C  from Saccharomyces cerevisiae S288C
>YLR221C|YLR221C RSA3 SGDID:S000004211, Chr XII from 579024-578362, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein with a likely role in ribosomal maturation, required for accumulation of wild-type levels of large (60S) ribosomal subunits; binds to the helicase Dbp6p in pre-60S ribosomal particles in the nucleolus" ORGANISM: Saccharomyces cerevisiae S288C (220 aa)
MSAGDISAINIKSVKKNRRRKKRRTADVSSSDSSSSDPSSESEKEEIQNGAIEEHVGENG
KSDHVFSKGNDEDKQEDIAIEVSDVELTDEESKDLKLNSKEVIDDLTKISLSKIPEPTKS
QNKEGFMNASKIAENIKLAREEYNELAENFVPKGKDKTKLREEYLNLLFENYGDDINRLR
AAPDFTNKSLSILADALQEGIGMFDIGELELVLKNKEMEN