Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR218C  from Saccharomyces cerevisiae S288C
>YLR218C|YLR218C COA4 SGDID:S000004208, Chr XII from 573918-573466, Genome Release 64-1-1, reverse complement, Verified ORF, "Twin Cx(9)C protein involved in cytochrome c oxidase assembly or stability; localizes to the mitochondrial intermembrane space via the Mia40p-Erv1p system; interacts genetically with CYC1 and with cytochrome c oxidase assembly factors" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MLLFSSFFSHNKCPKQKKGPQPLKVVKGTSKSCAKQGKIKGKEKLWQAKTGRLVMSETGE
TSEYYKQALEEYKEVQEDEDPDVWDTRISKTGCYVENLALQLCHAETGDWRQCFNEMALF
RKCWEKNGNRERVSTVDVDGTTSKDSEKKK