Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR200W  from Saccharomyces cerevisiae S288C
>YLR200W|YLR200W YKE2 SGDID:S000004190, Chr XII from 549012-549356, Genome Release 64-1-1, Verified ORF, "Subunit of the heterohexameric Gim/prefoldin protein complex involved in the folding of alpha-tubulin, beta-tubulin, and actin" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE
QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR