Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR193C  from Saccharomyces cerevisiae S288C
>YLR193C|YLR193C UPS1 SGDID:S000004183, Chr XII from 540536-540009, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial intermembrane space protein that regulates mitochondrial cardiolipin levels, null has defects in Mgm1p processing, integrity of mitochondrial inner membrane complexes, and mitochondrial morphology; ortholog of human PRELI" ORGANISM: Saccharomyces cerevisiae S288C (175 aa)
MVLLHKSTHIFPTDFASVSRAFFNRYPNPYSPHVLSIDTISRNVDQEGNLRTTRLLKKSG
KLPTWVKPFLRGITETWIIEVSVVNPANSTMKTYTRNLDHTGIMKVEEYTTYQFDSATSS
TIADSRVKFSSGFNMGIKSKVEDWSRTKFDENVKKSRMGMAFVIQKLEEARNPQF