Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR185W  from Saccharomyces cerevisiae S288C
>YLR185W|YLR185W RPL37A SGDID:S000004175, Chr XII from 522663-522669,523029-523288, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl37Bp and to rat L37 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (88 aa)
MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTG
TGRMRYLKHVSRRFKNGFQTGSASKASA