Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR179C  from Saccharomyces cerevisiae S288C
>YLR179C|YLR179C YLR179C SGDID:S000004169, Chr XII from 514713-514108, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function with similarity to Tfs1p; transcription is activated by paralogous proteins Yrm1p and Yrr1p along with proteins involved in multidrug resistance; GFP-tagged protein localizes to the cytoplasm and nucleus" ORGANISM: Saccharomyces cerevisiae S288C (201 aa)
MSSAIVAKLNKEDIIKDTVKDLAFEILGELSVSYVDSDDIKLGNPMPMEATQAAPTIKFT
PFDKSQLSAEDKLALLMTDPDAPSRTEHKWSEVCHYIITDIPVEYGPGGDIAISGKGVVR
NNYIGPGPPKNSGYHRYVFFLCKQPKGADSSTFTKVENIISWGYGTPGAGAYDYIKENNL
QLVGANYYMVENTTVDFNYDM