Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR170C  from Saccharomyces cerevisiae S288C
>YLR170C|YLR170C APS1 SGDID:S000004160, Chr XII from 501049-500579, Genome Release 64-1-1, reverse complement, Verified ORF, "Small subunit of the clathrin-associated adaptor complex AP-1, which is involved in protein sorting at the trans-Golgi network; homolog of the sigma subunit of the mammalian clathrin AP-1 complex" ORGANISM: Saccharomyces cerevisiae S288C (156 aa)
MTQLKYLLLVSRQGKIRLKKWYTAMSAGEKAKIVKDLTPTILARKPKMCNIIEYNDHKVV
YKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKVYDILNEM
IMCDGSIAESSRKEVLHHVTVMDTMESNDNLERVLS