Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR168C  from Saccharomyces cerevisiae S288C
>YLR168C|YLR168C UPS2 SGDID:S000004158, Chr XII from 500270-499578, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial intermembrane space protein involved in regulation of mitochondrial cardiolipin and phosphatidylethanolamine levels; null has defects in mitochondrial morphology; similar to Ups1p, Ups3p and to human PRELI" ORGANISM: Saccharomyces cerevisiae S288C (230 aa)
MKLFQNSYDFNYPWDQVTAANWKKYPNEISTHVIAVDVLRRELKDQGKVLVTERLITVKQ
GVPKWIMMMLGGTNMSHVREVSVVDLNKKSLTMRSCNLTMCNLLKVYETVTYSPHPDDSA
NKTLFQQEAQITAYGSIRKLCNKMEDWSVQRFCENAKKGKMGFDAVLQVFSENWEKHVDD
LSNQLVSKVNETMEDVKISAGTLLKGTERSGRTILQQNIDLFRDAYNHEN