Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR167W  from Saccharomyces cerevisiae S288C
>YLR167W|YLR167W RPS31 SGDID:S000004157, Chr XII from 498947-499405, Genome Release 64-1-1, Verified ORF, "Fusion protein that is cleaved to yield a ribosomal protein of the small (40S) subunit and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B" ORGANISM: Saccharomyces cerevisiae S288C (152 aa)
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAVLSYYKVDAEGKVTKLRRE
CSNPTCGAGVFLANHKDRLYCGKCHSVYKVNA