Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR164W  from Saccharomyces cerevisiae S288C
>YLR164W|YLR164W YLR164W SGDID:S000004154, Chr XII from 493883-494389, Genome Release 64-1-1, Verified ORF, "Mitochondrial inner membrane protein of unknown function; similar to Tim18p and Sdh4p; expression induced by nitrogen limitation in a GLN3, GAT1-dependent manner" ORGANISM: Saccharomyces cerevisiae S288C (168 aa)
MSSTKFLKPLCRIRAFHTSIARSFTIPFLPKIPQKPGGVSGTANDSSYMPPESRAQGSYH
WIVERGLSLAVLPLIAVPLVTTGPISTFTDTFLSLVLLGHCHIGFQSCIIDYISERVYGK
VHHYAMYLLSLGSFLSFVGIYKLESQEAGLIASLKSLWDNKPVEKKRQ