Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR162W-A  from Saccharomyces cerevisiae S288C
>YLR162W-A|YLR162W-A RRT15 SGDID:S000028567, Chr XII from 490406-490594, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR; identified in a screen for mutants with decreased levels of rDNA transcription" ORGANISM: Saccharomyces cerevisiae S288C (62 aa)
MVCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSPGEIYCFYINCIMN
RR