Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR162W  from Saccharomyces cerevisiae S288C
>YLR162W|YLR162W YLR162W SGDID:S000004152, Chr XII from 489573-489929, Genome Release 64-1-1, Verified ORF, "Putative protein of unknown function; overexpression confers resistance to the antimicrobial peptide MiAMP1 and causes growth arrest, apoptosis, and increased sensitivity to cobalt chloride" ORGANISM: Saccharomyces cerevisiae S288C (118 aa)
MQHTLTRTASLPERSSSAHSAATALPALRRPPDSCETLVPLLCIFWFVFVSMSPLPPARA
NKSDNKGLISADRNNKATLLLTIPRCTSKSYTNDLSPLKMTLLSAGKHPRPFRQEHRC